Lineage for d6a3wa_ (6a3w A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1083 PDB entries)
  8. 3058374Domain d6a3wa_: 6a3w A: [358436]
    Other proteins in same PDB: d6a3wb_, d6a3we_, d6a3wh_, d6a3wk_
    automated match to d4kv5e_
    complexed with nag

Details for d6a3wa_

PDB Entry: 6a3w (more details), 2 Å

PDB Description: complex structure of 4-1bb and utomilumab
PDB Compounds: (A:) utomilumab VH

SCOPe Domain Sequences for d6a3wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a3wa_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaevkkpgeslrisckgsgysfstywiswvrqmpgkglewmgkiypgdsytny
spsfqgqvtisadksistaylqwsslkasdtamyycargygifdywgqgtlvtvss

SCOPe Domain Coordinates for d6a3wa_:

Click to download the PDB-style file with coordinates for d6a3wa_.
(The format of our PDB-style files is described here.)

Timeline for d6a3wa_:

  • d6a3wa_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11