Lineage for d6czfb1 (6czf B:1-249)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548742Family d.153.1.1: Class II glutamine amidotransferases [56236] (7 proteins)
    has slightly different topology than other families do
  6. 3058367Protein automated matches [358429] (1 species)
    not a true protein
  7. 3058368Species Escherichia coli [TaxId:83333] [358430] (1 PDB entry)
  8. 3058370Domain d6czfb1: 6czf B:1-249 [358432]
    Other proteins in same PDB: d6czfb2, d6czfd2
    automated match to d1ecfa2
    complexed with g4p, mg

Details for d6czfb1

PDB Entry: 6czf (more details), 1.95 Å

PDB Description: the structure of e. coli purf in complex with ppgpp-mg
PDB Compounds: (B:) Amidophosphoribosyltransferase

SCOPe Domain Sequences for d6czfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6czfb1 d.153.1.1 (B:1-249) automated matches {Escherichia coli [TaxId: 83333]}
cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
rqcadnpvs

SCOPe Domain Coordinates for d6czfb1:

Click to download the PDB-style file with coordinates for d6czfb1.
(The format of our PDB-style files is described here.)

Timeline for d6czfb1:

  • d6czfb1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-11

View in 3D
Domains from same chain:
(mouse over for more information)
d6czfb2