Lineage for d6b88a_ (6b88 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2407493Fold b.87: LexA/Signal peptidase [51305] (1 superfamily)
    complex fold made of several coiled beta-sheets; contains an SH3-like barrel
  4. 2407494Superfamily b.87.1: LexA/Signal peptidase [51306] (3 families) (S)
  5. 2407531Family b.87.1.2: Type 1 signal peptidase [51312] (1 protein)
    contains additional all-beta subdomain inserted in the superfamily fold
  6. 2407532Protein Type 1 signal peptidase [51313] (1 species)
  7. 2407533Species Escherichia coli [TaxId:562] [51314] (6 PDB entries)
    Uniprot P00803 81-324
  8. 3058354Domain d6b88a_: 6b88 A: [358416]
    automated match to d1kn9a_
    complexed with 1pe, czd

Details for d6b88a_

PDB Entry: 6b88 (more details), 2.41 Å

PDB Description: e. coli lepb in complex with gne0775 ((4s,7s,10s)-10-((s)-4-amino-2- (2-(4-(tert-butyl)phenyl)-4-methylpyrimidine-5-carboxamido)-n- methylbutanamido)-16,26-bis(2-aminoethoxy)-n-(2-iminoethyl)-7-methyl- 6,9-dioxo-5,8-diaza-1,2(1,3)-dibenzenacyclodecaphane-4-carboxamide)
PDB Compounds: (A:) Signal peptidase I

SCOPe Domain Sequences for d6b88a_:

Sequence, based on SEQRES records: (download)

>d6b88a_ b.87.1.2 (A:) Type 1 signal peptidase {Escherichia coli [TaxId: 562]}
rsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfkyp
edpkldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvqtf
srrnggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqpgq
qlatwivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdkqegewptglrl
sriggih

Sequence, based on observed residues (ATOM records): (download)

>d6b88a_ b.87.1.2 (A:) Type 1 signal peptidase {Escherichia coli [TaxId: 562]}
rsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfkyp
edpkldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvqtf
srrnggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqpgq
qlatwivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdglrlsriggih

SCOPe Domain Coordinates for d6b88a_:

Click to download the PDB-style file with coordinates for d6b88a_.
(The format of our PDB-style files is described here.)

Timeline for d6b88a_:

  • d6b88a_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-11