Lineage for d6mgxb_ (6mgx B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555486Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2555487Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2555981Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2555982Protein automated matches [190418] (22 species)
    not a true protein
  7. 2556001Species Escherichia coli [TaxId:562] [226145] (14 PDB entries)
  8. 3058341Domain d6mgxb_: 6mgx B: [358403]
    automated match to d4eyba_
    complexed with so4, zn

Details for d6mgxb_

PDB Entry: 6mgx (more details), 2.6 Å

PDB Description: crystal structure of the new deli metallo beta lactamase variant 6 klebsiella pneumoniae
PDB Compounds: (B:) metallo-beta-lactamase

SCOPe Domain Sequences for d6mgxb_:

Sequence, based on SEQRES records: (download)

>d6mgxb_ d.157.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
tgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaq
ilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhs
ltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgn
lgdadtehyaasvrafgaafpkasmivmshsapdsraaithtarmadklr

Sequence, based on observed residues (ATOM records): (download)

>d6mgxb_ d.157.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
tgdqrfgdlvfrqlapnvwqhtsyldmgavasnglivrdggrvlvvdtawtddqtaqiln
wikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltf
aangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlgd
adtehyaasvrafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d6mgxb_:

Click to download the PDB-style file with coordinates for d6mgxb_.
(The format of our PDB-style files is described here.)

Timeline for d6mgxb_:

  • d6mgxb_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-04