Lineage for d6gr3a_ (6gr3 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537078Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2537320Protein automated matches [190229] (11 species)
    not a true protein
  7. 2537333Species Human (Homo sapiens) [TaxId:9606] [187292] (136 PDB entries)
  8. 3058337Domain d6gr3a_: 6gr3 A: [358399]
    automated match to d2xjxa_
    complexed with an2, mg

Details for d6gr3a_

PDB Entry: 6gr3 (more details), 1.88 Å

PDB Description: structure of human heat shock protein 90-alpha n-terminal domain (hsp90-ntd) variant k112r in complex with amppnp
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d6gr3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gr3a_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskl
dsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiarsgtkafmealqagadism
igqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhl
kedqteyleerrikeivkkhsqfigypitlfvek

SCOPe Domain Coordinates for d6gr3a_:

Click to download the PDB-style file with coordinates for d6gr3a_.
(The format of our PDB-style files is described here.)

Timeline for d6gr3a_:

  • d6gr3a_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-04