Lineage for d5yh4a_ (5yh4 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2385622Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2385751Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2385752Protein automated matches [190445] (8 species)
    not a true protein
  7. 3058315Species Vitis vinifera [TaxId:29760] [358377] (1 PDB entry)
  8. 3058316Domain d5yh4a_: 5yh4 A: [358378]
    automated match to d1r8na_
    complexed with edo

Details for d5yh4a_

PDB Entry: 5yh4 (more details), 1.3 Å

PDB Description: miraculin-like protein from vitis vinifera
PDB Compounds: (A:) mirauclin-like protein

SCOPe Domain Sequences for d5yh4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yh4a_ b.42.4.0 (A:) automated matches {Vitis vinifera [TaxId: 29760]}
esapdpvldtegkqlrsgvdyyilpvirgrgggltlastgnencpldvvqeqhevsnglp
ltftpvnpkkgvirvstdhnikfsasticvqstlwkleydessgqrfvttggvegnpgre
tldnwfkiekyeddyklvfcptvcdfckpvcgdigiyiqngyrrlalsdvpfkvmfkka

SCOPe Domain Coordinates for d5yh4a_:

Click to download the PDB-style file with coordinates for d5yh4a_.
(The format of our PDB-style files is described here.)

Timeline for d5yh4a_:

  • d5yh4a_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-04