Lineage for d5z2ja_ (5z2j A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484691Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2484798Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2485108Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2485109Protein automated matches [190944] (36 species)
    not a true protein
  7. 3058303Species Liberibacter asiaticus [TaxId:537021] [358365] (3 PDB entries)
  8. 3058310Domain d5z2ja_: 5z2j A: [358372]
    automated match to d1xvla1
    complexed with act, gol, so4; mutant

Details for d5z2ja_

PDB Entry: 5z2j (more details), 1.87 Å

PDB Description: structure of s38a mutant metal-free periplasmic metal binding protein from candidatus liberibacter asiaticus
PDB Compounds: (A:) Periplasmic solute binding protein

SCOPe Domain Sequences for d5z2ja_:

Sequence, based on SEQRES records: (download)

>d5z2ja_ c.92.2.0 (A:) automated matches {Liberibacter asiaticus [TaxId: 537021]}
kkvvlssfsiigditqniakdlvtvttlveagndahsyqvtsadaikiqnadlilcnglh
leetymkyftnlkkgtkiitvtdginpigvsedtsvdsepnphawmsltnamiyienirk
altaldpsnakkyelnareysekirnsilplktriekvdpekrwfvtsegclvylaedfg
fkslylwpinsdserspsmmrhainqmrshkikfifsestnsdqpakqvayetnasyggv
lyvdslskpdgpaptyldllrfsltkivdtlf

Sequence, based on observed residues (ATOM records): (download)

>d5z2ja_ c.92.2.0 (A:) automated matches {Liberibacter asiaticus [TaxId: 537021]}
kkvvlssfsiigditqniakdlvtvttlveagndahsyqvtsadaikiqnadlilcnglh
leetymkyftnlkkgtkiitvtdginpigvsedtsvdsepnphawmsltnamiyienirk
altaldpsnakkyelnareysekirnsilplktriekvdpekrwfvtsegclvylaedfg
fkslylwpinsdrspsmmrhainqmrshkikfifsestnsdqpakqvayetnasyggvly
vdslskpdgpaptyldllrfsltkivdtlf

SCOPe Domain Coordinates for d5z2ja_:

Click to download the PDB-style file with coordinates for d5z2ja_.
(The format of our PDB-style files is described here.)

Timeline for d5z2ja_:

  • d5z2ja_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-04