Lineage for d5ybzd1 (5ybz D:125-255)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2372079Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2372080Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2372417Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2372418Protein automated matches [190873] (4 species)
    not a true protein
  7. 2372484Species Mouse (Mus musculus) [TaxId:10090] [271469] (9 PDB entries)
  8. 3058300Domain d5ybzd1: 5ybz D:125-255 [358362]
    Other proteins in same PDB: d5ybza2, d5ybza3, d5ybzc2, d5ybzc3, d5ybzd2, d5ybzd3
    automated match to d2wnva_
    complexed with ca, cl, dms, na, so4

Details for d5ybzd1

PDB Entry: 5ybz (more details), 1.71 Å

PDB Description: high resolution structure of complement c1q-like protein 3 c1q domain
PDB Compounds: (D:) Complement C1q-like protein 3

SCOPe Domain Sequences for d5ybzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ybzd1 b.22.1.0 (D:125-255) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pkiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmrggdg
tsmwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggnnnky
stfsgfiiyad

SCOPe Domain Coordinates for d5ybzd1:

Click to download the PDB-style file with coordinates for d5ybzd1.
(The format of our PDB-style files is described here.)

Timeline for d5ybzd1:

  • d5ybzd1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-04