Lineage for d6mfka1 (6mfk A:1-208)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403213Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2403214Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2403254Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins)
  6. 2403321Protein automated matches [190704] (5 species)
    not a true protein
  7. 3058285Species Elizabethkingia anophelis [TaxId:1117645] [358347] (1 PDB entry)
  8. 3058286Domain d6mfka1: 6mfk A:1-208 [358348]
    Other proteins in same PDB: d6mfka2
    automated match to d2xata_
    complexed with mpd, po4

Details for d6mfka1

PDB Entry: 6mfk (more details), 1.65 Å

PDB Description: crystal structure of chloramphenicol acetyltransferase from elizabethkingia anophelis
PDB Compounds: (A:) Chloramphenicol acetyltransferase

SCOPe Domain Sequences for d6mfka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mfka1 b.81.1.3 (A:1-208) automated matches {Elizabethkingia anophelis [TaxId: 1117645]}
mknffespfkgkiikdhiqnpniiagkysyysgyyhghsfddcaryllpdrndvdkliig
sycsvgtgasfimagnqghrydwissfpffymneveafensidafknagdtiigndvwig
geamimpgikigdgavigsralvtkdvepyaivggnpaklikkrfsenqiailleikwwe
wneevladampilcsgnidllykfykni

SCOPe Domain Coordinates for d6mfka1:

Click to download the PDB-style file with coordinates for d6mfka1.
(The format of our PDB-style files is described here.)

Timeline for d6mfka1:

  • d6mfka1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-04

View in 3D
Domains from same chain:
(mouse over for more information)
d6mfka2