Lineage for d6mjnd1 (6mjn D:1-138)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564444Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. 2564445Superfamily d.227.1: OsmC-like [82784] (3 families) (S)
  5. 2564519Family d.227.1.0: automated matches [191395] (1 protein)
    not a true family
  6. 2564520Protein automated matches [190512] (5 species)
    not a true protein
  7. 3058261Species Legionella pneumophila [TaxId:446] [358323] (1 PDB entry)
  8. 3058280Domain d6mjnd1: 6mjn D:1-138 [358342]
    Other proteins in same PDB: d6mjnb2, d6mjnd2
    automated match to d1n2fa_
    complexed with cl

Details for d6mjnd1

PDB Entry: 6mjn (more details), 1.75 Å

PDB Description: crystal structure of an organic hydroperoxide resistance protein osmc, predicted redox protein, regulator of sulfide bond formation from legionella pneumophila
PDB Compounds: (D:) organic hydroperoxide resistance protein

SCOPe Domain Sequences for d6mjnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mjnd1 d.227.1.0 (D:1-138) automated matches {Legionella pneumophila [TaxId: 446]}
mkalyttiakahggrnghvettdgllkldlamprelggeggatnpeqlfaagyaacfesa
irhvanvqkisledvsmtsevslyatpekgfklgvalhahitglnqneaealvakahevc
pysnairgnvdvklsvsv

SCOPe Domain Coordinates for d6mjnd1:

Click to download the PDB-style file with coordinates for d6mjnd1.
(The format of our PDB-style files is described here.)

Timeline for d6mjnd1:

  • d6mjnd1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-04