Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.227: OsmC-like [82783] (1 superfamily) swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix |
Superfamily d.227.1: OsmC-like [82784] (3 families) |
Family d.227.1.0: automated matches [191395] (1 protein) not a true family |
Protein automated matches [190512] (7 species) not a true protein |
Species Legionella pneumophila [TaxId:446] [358323] (1 PDB entry) |
Domain d6mjnd1: 6mjn D:1-138 [358342] Other proteins in same PDB: d6mjnb2, d6mjnd2 automated match to d1n2fa_ complexed with cl |
PDB Entry: 6mjn (more details), 1.75 Å
SCOPe Domain Sequences for d6mjnd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mjnd1 d.227.1.0 (D:1-138) automated matches {Legionella pneumophila [TaxId: 446]} mkalyttiakahggrnghvettdgllkldlamprelggeggatnpeqlfaagyaacfesa irhvanvqkisledvsmtsevslyatpekgfklgvalhahitglnqneaealvakahevc pysnairgnvdvklsvsv
Timeline for d6mjnd1:
View in 3D Domains from other chains: (mouse over for more information) d6mjna_, d6mjnb1, d6mjnb2, d6mjnc_ |