Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (29 species) not a true protein |
Species Naegleria fowleri [TaxId:5763] [339972] (2 PDB entries) |
Domain d6mked_: 6mke D: [358341] automated match to d2ki3a_ complexed with fk5 |
PDB Entry: 6mke (more details), 2.05 Å
SCOPe Domain Sequences for d6mked_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mked_ d.26.1.0 (D:) automated matches {Naegleria fowleri [TaxId: 5763]} tdwipisqdqrlkkkiitagssdeqppigskvsvhytgtltsgkkfdssldrgqpfvftl gkgevirgwdlgvksmkkgeksyfeipsdyaygnnaipglipanstlmfeiellswk
Timeline for d6mked_: