Lineage for d6mira_ (6mir A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2498051Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2498052Protein automated matches [190230] (21 species)
    not a true protein
  7. 3058254Species Ananas comosus [TaxId:4615] [358316] (2 PDB entries)
  8. 3058273Domain d6mira_: 6mir A: [358335]
    automated match to d1iwda_

Details for d6mira_

PDB Entry: 6mir (more details), 1.73 Å

PDB Description: native ananain from ananas comosus
PDB Compounds: (A:) Ananain

SCOPe Domain Sequences for d6mira_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mira_ d.3.1.0 (A:) automated matches {Ananas comosus [TaxId: 4615]}
vpqsidwrdsgavtsvknqgrcgscwafasiatvesiykikrgnlvslseqqvldcavsy
gckggwinkaysfiisnkgvasaaiypykaakgtcktngvpnsayitrytyvqrnnernm
myavsnqpiaaaldasgnfqhykrgvftgpcgtrlnhaiviigygqdssgkkfwivrnsw
gagwgeggyirlardvsssfglcgiamdplyptlq

SCOPe Domain Coordinates for d6mira_:

Click to download the PDB-style file with coordinates for d6mira_.
(The format of our PDB-style files is described here.)

Timeline for d6mira_:

  • d6mira_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-04

View in 3D
Domains from other chains:
(mouse over for more information)
d6mirb_