Lineage for d6misb_ (6mis B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2498051Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2498052Protein automated matches [190230] (21 species)
    not a true protein
  7. 3058254Species Ananas comosus [TaxId:4615] [358316] (2 PDB entries)
  8. 3058271Domain d6misb_: 6mis B: [358333]
    automated match to d1iwda_
    complexed with e64

Details for d6misb_

PDB Entry: 6mis (more details), 1.98 Å

PDB Description: native ananain in complex with e-64
PDB Compounds: (B:) Ananain

SCOPe Domain Sequences for d6misb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6misb_ d.3.1.0 (B:) automated matches {Ananas comosus [TaxId: 4615]}
vpqsidwrdsgavtsvknqgrcgscwafasiatvesiykikrgnlvslseqqvldcavsy
gckggwinkaysfiisnkgvasaaiypykaakgtcktngvpnsayitrytyvqrnnernm
myavsnqpiaaaldasgnfqhykrgvftgpcgtrlnhaiviigygqdssgkkfwivrnsw
gagwgeggyirlardvsssfglcgiamdplyptlq

SCOPe Domain Coordinates for d6misb_:

Click to download the PDB-style file with coordinates for d6misb_.
(The format of our PDB-style files is described here.)

Timeline for d6misb_:

  • d6misb_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-04