Lineage for d5nbka1 (5nbk A:32-270)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555486Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2555487Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2555981Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2555982Protein automated matches [190418] (22 species)
    not a true protein
  7. 2556016Species Klebsiella pneumoniae [TaxId:573] [189718] (58 PDB entries)
  8. 3058268Domain d5nbka1: 5nbk A:32-270 [358330]
    Other proteins in same PDB: d5nbka2, d5nbkc2
    automated match to d5zh1b_
    complexed with cl, p6g, pg4, zn

Details for d5nbka1

PDB Entry: 5nbk (more details), 2.6 Å

PDB Description: ndm-1 metallo-beta-lactamase: a parsimonious interpretation of the diffraction data
PDB Compounds: (A:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d5nbka1:

Sequence, based on SEQRES records: (download)

>d5nbka1 d.157.1.0 (A:32-270) automated matches {Klebsiella pneumoniae [TaxId: 573]}
rptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdt
awtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapq
egmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclik
dskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

Sequence, based on observed residues (ATOM records): (download)

>d5nbka1 d.157.1.0 (A:32-270) automated matches {Klebsiella pneumoniae [TaxId: 573]}
rptigqqmetgdqrfgdlvfrqlapnvwqhtsyldgavasnglivrdggrvlvvdtawtd
dqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmv
aaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdska
kslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d5nbka1:

Click to download the PDB-style file with coordinates for d5nbka1.
(The format of our PDB-style files is described here.)

Timeline for d5nbka1:

  • d5nbka1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-04

View in 3D
Domains from same chain:
(mouse over for more information)
d5nbka2