Lineage for d6mgyb_ (6mgy B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555486Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2555487Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2555981Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2555982Protein automated matches [190418] (22 species)
    not a true protein
  7. 2556016Species Klebsiella pneumoniae [TaxId:573] [189718] (58 PDB entries)
  8. 3058266Domain d6mgyb_: 6mgy B: [358328]
    automated match to d4eyba_
    complexed with gol, k, zn

Details for d6mgyb_

PDB Entry: 6mgy (more details), 1.6 Å

PDB Description: crystal structure of the new deli metallo beta lactamase variant 5 from klebsiella pneumoniae
PDB Compounds: (B:) Metallo-beta-lactamase NDM-5

SCOPe Domain Sequences for d6mgyb_:

Sequence, based on SEQRES records: (download)

>d6mgyb_ d.157.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
gdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvllvdtawtddqtaqi
lnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeglvaaqhsl
tfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnl
gdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

Sequence, based on observed residues (ATOM records): (download)

>d6mgyb_ d.157.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
gdqrfgdlvfrqlapnvwqhtsyldmgavasnglivrdggrvllvdtawtddqtaqilnw
ikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeglvaaqhsltfa
angwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlgda
dtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d6mgyb_:

Click to download the PDB-style file with coordinates for d6mgyb_.
(The format of our PDB-style files is described here.)

Timeline for d6mgyb_:

  • d6mgyb_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-04