Lineage for d6mkea_ (6mke A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2509610Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2509611Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2509932Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2509933Protein automated matches [191162] (27 species)
    not a true protein
  7. 2510019Species Naegleria fowleri [TaxId:5763] [339972] (2 PDB entries)
  8. 3058259Domain d6mkea_: 6mke A: [358321]
    automated match to d2ki3a_
    complexed with fk5

Details for d6mkea_

PDB Entry: 6mke (more details), 2.05 Å

PDB Description: crystal structure of peptidylprolyl isomerase from naegleria fowleri with bound fk506
PDB Compounds: (A:) peptidylprolyl isomerase

SCOPe Domain Sequences for d6mkea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mkea_ d.26.1.0 (A:) automated matches {Naegleria fowleri [TaxId: 5763]}
tdwipisqdqrlkkkiitagssdeqppigskvsvhytgtltsgkkfdssldrgqpfvftl
gkgevirgwdlgvksmkkgeksyfeipsdyaygnnaipglipanstlmfeiellswk

SCOPe Domain Coordinates for d6mkea_:

Click to download the PDB-style file with coordinates for d6mkea_.
(The format of our PDB-style files is described here.)

Timeline for d6mkea_:

  • d6mkea_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-04