Lineage for d6b6if_ (6b6i F:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2389935Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2390138Protein automated matches [190384] (20 species)
    not a true protein
  7. 3058131Species Norovirus gii.4 [TaxId:489821] [358193] (1 PDB entry)
  8. 3058253Domain d6b6if_: 6b6i F: [358315]
    automated match to d2fyqa_

Details for d6b6if_

PDB Entry: 6b6i (more details), 2.44 Å

PDB Description: 2.4a resolution structure of human norovirus gii.4 protease
PDB Compounds: (F:) 3C-like protease

SCOPe Domain Sequences for d6b6if_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b6if_ b.47.1.4 (F:) automated matches {Norovirus gii.4 [TaxId: 489821]}
siwsrivnfgsgwgfwvspslfitsthvipqgakeffgvpikqiqvhksgefcrlrfpkp
irtdvtgmileegapegtvvtllikrstgelmplaarmgthatmkiqgrtvggqmgmllt
gsnaksmdlgttpgdagcpyiykrgndyvvigvhtaaarggntvicatqggegeatle

SCOPe Domain Coordinates for d6b6if_:

Click to download the PDB-style file with coordinates for d6b6if_.
(The format of our PDB-style files is described here.)

Timeline for d6b6if_:

  • d6b6if_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-04