Lineage for d6hpgf_ (6hpg F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2334081Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2334082Protein automated matches [191037] (12 species)
    not a true protein
  7. 2334128Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225165] (2 PDB entries)
  8. 3058233Domain d6hpgf_: 6hpg F: [358295]
    automated match to d2vyib_

Details for d6hpgf_

PDB Entry: 6hpg (more details), 2 Å

PDB Description: arabidopsis om64 tpr domain
PDB Compounds: (F:) Outer envelope protein 64, mitochondrial

SCOPe Domain Sequences for d6hpgf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hpgf_ a.118.8.0 (F:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gnmeasevmkekgnaaykgkqwnkavnfyteaiklnganatyycnraaaflelccfqqae
qdctkamlidkknvkaylrrgtareslvrykeaaadfrhalvlepqnktakvaekrl

SCOPe Domain Coordinates for d6hpgf_:

Click to download the PDB-style file with coordinates for d6hpgf_.
(The format of our PDB-style files is described here.)

Timeline for d6hpgf_:

  • d6hpgf_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-04