Lineage for d6gqua1 (6gqu A:1-226)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537078Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2537079Protein HSP90 [55876] (3 species)
  7. 2537164Species Human (Homo sapiens) [TaxId:9606] [55878] (144 PDB entries)
    Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
  8. 3058229Domain d6gqua1: 6gqu A:1-226 [358291]
    Other proteins in same PDB: d6gqua2
    automated match to d4egia_
    complexed with cmp

Details for d6gqua1

PDB Entry: 6gqu (more details), 1.72 Å

PDB Description: structure of human heat shock protein 90-alpha n-terminal domain (hsp90-ntd) variant k112r in complex with camp
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d6gqua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gqua1 d.122.1.1 (A:1-226) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
mpeetqtqdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkir
yesltdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiarsgtkafme
alqagadismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepm
grgtkvilhlkedqteyleerrikeivkkhsqfigypitlfveker

SCOPe Domain Coordinates for d6gqua1:

Click to download the PDB-style file with coordinates for d6gqua1.
(The format of our PDB-style files is described here.)

Timeline for d6gqua1:

  • d6gqua1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-04

View in 3D
Domains from same chain:
(mouse over for more information)
d6gqua2