Lineage for d6gsba1 (6gsb A:23-85)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2302754Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303043Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2303322Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2303323Protein automated matches [226859] (35 species)
    not a true protein
  7. 2303473Species Sphingobacterium spiritivorum [TaxId:258] [275545] (3 PDB entries)
  8. 3058226Domain d6gsba1: 6gsb A:23-85 [358288]
    Other proteins in same PDB: d6gsba2, d6gsba3, d6gsbb2, d6gsbb3
    automated match to d4yeta1
    complexed with mn

Details for d6gsba1

PDB Entry: 6gsb (more details), 1.45 Å

PDB Description: sphingobacterium sp. t2 manganese superoxide dismutase catalyses the oxidative demethylation of polymeric lignin via generation of hydroxyl radical
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d6gsba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gsba1 a.2.11.0 (A:23-85) automated matches {Sphingobacterium spiritivorum [TaxId: 258]}
meihhskhaagytanlnkaiagtpaekesienilakvsqysdavrnnagghynhelfwsi
ltp

SCOPe Domain Coordinates for d6gsba1:

Click to download the PDB-style file with coordinates for d6gsba1.
(The format of our PDB-style files is described here.)

Timeline for d6gsba1:

  • d6gsba1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-04