Lineage for d6b65a_ (6b65 A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570739Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2570740Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2570741Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 2570750Protein Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase [56665] (5 species)
  7. 3058125Species Archaeoglobus fulgidus [TaxId:224325] [358187] (7 PDB entries)
  8. 3058214Domain d6b65a_: 6b65 A: [358276]
    automated match to d1lbva_
    complexed with ipa, mg, peg, so4

Details for d6b65a_

PDB Entry: 6b65 (more details), 2.7 Å

PDB Description: impase (af2372) r92q/k164e
PDB Compounds: (A:) Fructose-1,6-bisphosphatase/inositol-1-monophosphatase

SCOPe Domain Sequences for d6b65a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b65a_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeoglobus fulgidus [TaxId: 224325]}
mderdalrisreiagevrkaiasmplrervkdvgmgkdgtptkaadrvaedaaleilrke
rvtvvteesgvlgegdvfvaldpldgtfnatqgipvysvslcfsysdklkdaffgyvynl
atgdeyyadssgayrngerievsdaeelycnaiiyypdrkfpfermrifgsaatelcffa
dgsfdcfldirpgkmlriydaaagvfiaekaggkvteldgeslgnkkfdmqerlnivaan
eklhpkllelik

SCOPe Domain Coordinates for d6b65a_:

Click to download the PDB-style file with coordinates for d6b65a_.
(The format of our PDB-style files is described here.)

Timeline for d6b65a_:

  • d6b65a_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-04