Lineage for d6euma_ (6eum A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555486Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2555487Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2555488Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2555489Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 2555502Species Bacillus cereus [TaxId:1396] [56284] (29 PDB entries)
    Uniprot P04190 31-257
  8. 3058210Domain d6euma_: 6eum A: [358272]
    automated match to d1mqoa_
    complexed with by5, gol, so4, zn

Details for d6euma_

PDB Entry: 6eum (more details), 1.18 Å

PDB Description: crystal structure of bcii metallo-beta-lactamase in complex with dz- 307
PDB Compounds: (A:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d6euma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6euma_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]}
ktviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltk
eliemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplg
dlqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvaday
vnewstsienvlkryrninavvpghgevgdkglllhtldllk

SCOPe Domain Coordinates for d6euma_:

Click to download the PDB-style file with coordinates for d6euma_.
(The format of our PDB-style files is described here.)

Timeline for d6euma_:

  • d6euma_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-04