SCOPe 2.08: Domain d6frnd1: 6frn D:1-255

Lineage for d6frnd1 (6frn D:1-255)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (31 species)
   not a true protein

7. Species Methanothermococcus thermolithotrophicus [TaxId:2186] [358261] (4 PDB entries)

8. Domain d6frnd1: 6frn D:1-255 [358269]
   Other proteins in same PDB: d6frna2, d6frnb2, d6frnc2, d6frnd2
   automated match to d2ohha1
   complexed with 7mt, ca, fmn, gol, na, pe4, tb

Details for d6frnd1

PDB Entry: 6frn, 1.74 Å

PDB Description: structure of f420h2 oxidase (fpra) co-crystallized with 10mm tb-xo4 and calcium chloride

PDB Compounds: (D:) F420H2 oxidase (FprA)

SCOPe Domain Sequences for d6frnd1:

Sequence; same for both SEQRES and ATOM records:

>d6frnd1 d.157.1.0 (D:1-255) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 2186]}
mkadavkiadgvywvgvldwdirmyhgytlngttynaylvfgddkvalidntypgtsaqm
wgrikdacekegrefkidvivqnhvekdhsgalpeihkkfpeapiyctevaveglvkhfp
slkgapfkvvkslesidlggktltfleapllhwpdsmftlyaeegilfsndafgqhlcft
qrfdheipenilmdanqkfyanlitplsklvlkkfkevielgllekikmiapshgqiwtd
pmkvigayqdfatgk

Timeline for d6frnd1:

• d6frnd1 first appeared in SCOPe 2.07