Lineage for d6dwvc_ (6dwv C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2419618Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2420241Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2420242Protein automated matches [190150] (26 species)
    not a true protein
  7. 2420385Species Sphingobium sp. [TaxId:627192] [339663] (4 PDB entries)
  8. 3058176Domain d6dwvc_: 6dwv C: [358238]
    automated match to d4ofca_
    complexed with zn

Details for d6dwvc_

PDB Entry: 6dwv (more details), 2.2 Å

PDB Description: crystal structure of the ligj hydratase in the apo state
PDB Compounds: (C:) 4-oxalomesaconate hydratase

SCOPe Domain Sequences for d6dwvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dwvc_ c.1.9.0 (C:) automated matches {Sphingobium sp. [TaxId: 627192]}
miidchghytvlpkahdewreqqkaafkagqpappypeisddeiretieanqlrlikerg
admtifsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspeadmt
ssiaelercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvsgs
cnpamhatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrgladml
kqpsldtllmnnvffdtcvyhqpginlladvidnknilfgsemvgavrgidpttghyfdd
tkryidaldisdqerhaifegntrrvfprldaklkargl

SCOPe Domain Coordinates for d6dwvc_:

Click to download the PDB-style file with coordinates for d6dwvc_.
(The format of our PDB-style files is described here.)

Timeline for d6dwvc_:

  • d6dwvc_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-04