Lineage for d6dxkb_ (6dxk B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2335444Protein Glucocorticoid receptor [89140] (1 species)
  7. 2335445Species Human (Homo sapiens) [TaxId:9606] [89141] (8 PDB entries)
  8. 3058172Domain d6dxkb_: 6dxk B: [358234]
    automated match to d1m2za_
    complexed with hj4

Details for d6dxkb_

PDB Entry: 6dxk (more details), 3.05 Å

PDB Description: glucocorticoid receptor in complex with compound 11
PDB Compounds: (B:) Glucocorticoid receptor

SCOPe Domain Sequences for d6dxkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dxkb_ a.123.1.1 (B:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]}
ptlvsaletiepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfrnlhl
ddqmtllqyswmylmafalgwrsyrqssanllcfapdliineqrmtlpdmydqckhmlyv
sselhrlqvsyeeylcmktllllssvpkdglksqalfdairmtyikelgkaivkregnss
qnsqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkysngni
kkllfhqk

SCOPe Domain Coordinates for d6dxkb_:

Click to download the PDB-style file with coordinates for d6dxkb_.
(The format of our PDB-style files is described here.)

Timeline for d6dxkb_:

  • d6dxkb_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-04