Lineage for d6azya2 (6azy A:156-546)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (139 species)
    not a true protein
  7. 3058147Species Calcarisporiella thermophila [TaxId:911321] [358209] (1 PDB entry)
  8. 3058148Domain d6azya2: 6azy A:156-546 [358210]
    Other proteins in same PDB: d6azya1
    automated match to d1qvra2
    complexed with adp; mutant

Details for d6azya2

PDB Entry: 6azy (more details), 2.7 Å

PDB Description: crystal structure of hsp104 r328m/r757m mutant from calcarisporiella thermophila
PDB Compounds: (A:) Heat shock protein Hsp104

SCOPe Domain Sequences for d6azya2:

Sequence, based on SEQRES records: (download)

>d6azya2 c.37.1.0 (A:156-546) automated matches {Calcarisporiella thermophila [TaxId: 911321]}
ayealskycidltelaasgkldpvigrdeiisrvirvlsrrtknnpclvgepgvgktaia
eglanrivkgdipsslqkkvysldigsllagakyrgefeerlkavlkelkeaqaivfide
ihtvlgagksegaidaanllkpmlargelrcigattlteyrqyvekdpafermfqlvmve
epsvtdtisilrglkeryethhgvriadaaivaaaqlaaryitqrfmpdkaidlideaca
ntrvqldsqpeaidklerrhlqleveatalekekdaaskqrlqevraemariqeelrplk
mkyesekgrldeirnlsqrldelkakaedaerrydlaraadiryyaipdlekrlaqlqae
ksqadaeradgllaevvgpdqimevvsrwtg

Sequence, based on observed residues (ATOM records): (download)

>d6azya2 c.37.1.0 (A:156-546) automated matches {Calcarisporiella thermophila [TaxId: 911321]}
ayealskycidltelaasgkldpvigrdeiisrvirvlsrrtknnpclvgepgvgktaia
eglanrivkgdipsslqkkvysldigsllagagefeerlkavlkelkeaqaivfideiht
vlgaaidaanllkpmlargelrcigattlteyrqyvekdpafermfqlvmveepsvtdti
silrglkeryethhgvriadaaivaaaqlaaryitqrfmpdkaidlideacantrvqlds
qpeaidklerrhlqleveatalekekdaaskqrlqevraemariqeelrplkmkyesekg
rldeirnlsqrldelkakaedaerrydlaraadiryyaipdlekrlaqlqaeksqadaer
adgllaevvgpdqimevvsrwtg

SCOPe Domain Coordinates for d6azya2:

Click to download the PDB-style file with coordinates for d6azya2.
(The format of our PDB-style files is described here.)

Timeline for d6azya2:

  • d6azya2 appears in periodic updates to SCOPe 2.07 starting on 2018-10-04