Lineage for d6azya1 (6azy A:2-144)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341422Fold a.174: Double Clp-N motif [81922] (1 superfamily)
    multihelical; array
  4. 2341423Superfamily a.174.1: Double Clp-N motif [81923] (2 families) (S)
    duplication: contains two structural repeats of 4-helical motif
  5. 3058143Family a.174.1.0: automated matches [358205] (1 protein)
    not a true family
  6. 3058144Protein automated matches [358206] (1 species)
    not a true protein
  7. 3058145Species Calcarisporiella thermophila [TaxId:911321] [358207] (1 PDB entry)
  8. 3058146Domain d6azya1: 6azy A:2-144 [358208]
    Other proteins in same PDB: d6azya2, d6azya3
    automated match to d1qvra1
    complexed with adp; mutant

Details for d6azya1

PDB Entry: 6azy (more details), 2.7 Å

PDB Description: crystal structure of hsp104 r328m/r757m mutant from calcarisporiella thermophila
PDB Compounds: (A:) Heat shock protein Hsp104

SCOPe Domain Sequences for d6azya1:

Sequence, based on SEQRES records: (download)

>d6azya1 a.174.1.0 (A:2-144) automated matches {Calcarisporiella thermophila [TaxId: 911321]}
ssmqftdkatetlnaaakyaaenshvqlhpshvavvmldeenslfrsilekaggdvvsie
rgfkkimvrqpsqdppptemghspelakllhyahehmkkqrdlyiaqdhlilaladlpsm
aqvlkeggvtkkslenavthvrg

Sequence, based on observed residues (ATOM records): (download)

>d6azya1 a.174.1.0 (A:2-144) automated matches {Calcarisporiella thermophila [TaxId: 911321]}
ssmqftdkatetlnaaakyaaenshvqlhpshvavvmldeenslfrsilekaggdvvsie
rgfkkimvrqpsqdemghspelakllhyahehmkkqrdlyiaqdhlilaladlpsmaqvl
keggvtkkslenavthvrg

SCOPe Domain Coordinates for d6azya1:

Click to download the PDB-style file with coordinates for d6azya1.
(The format of our PDB-style files is described here.)

Timeline for d6azya1:

  • d6azya1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-04