Lineage for d6b84b_ (6b84 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338840Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2338841Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2338846Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2339218Protein automated matches [190139] (26 species)
    not a true protein
  7. 2339231Species Bothrops moojeni [TaxId:98334] [188126] (9 PDB entries)
  8. 3058133Domain d6b84b_: 6b84 B: [358195]
    automated match to d4kf3a_
    complexed with so4

Details for d6b84b_

PDB Entry: 6b84 (more details), 2 Å

PDB Description: crystal structure of myotoxin ii from bothrops moojeni
PDB Compounds: (B:) Basic phospholipase A2 homolog 2

SCOPe Domain Sequences for d6b84b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b84b_ a.133.1.2 (B:) automated matches {Bothrops moojeni [TaxId: 98334]}
slfelgkmilqetgknpaksygvygcncgvggrgkpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennsclkelcecdkavaiclrenldtynkkyrynylkpfckkad
pc

SCOPe Domain Coordinates for d6b84b_:

Click to download the PDB-style file with coordinates for d6b84b_.
(The format of our PDB-style files is described here.)

Timeline for d6b84b_:

  • d6b84b_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-04