Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) automatically mapped to Pfam PF00927 |
Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74849] (5 PDB entries) GDP-binding protein |
Domain d6a8pc3: 6a8p C:471-585 [358183] Other proteins in same PDB: d6a8pa1, d6a8pa2, d6a8pa5, d6a8pb1, d6a8pb2, d6a8pb5, d6a8pc1, d6a8pc2 automated match to d3ly6a3 complexed with gtp; mutant |
PDB Entry: 6a8p (more details), 2.54 Å
SCOPe Domain Sequences for d6a8pc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a8pc3 b.1.5.1 (C:471-585) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme [TaxId: 9606]} tgmamrirvgqsmnmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtkyll nlnlepfseksvplcilyekyrdcltesnlikvrallvepvinsyllaerdlyle
Timeline for d6a8pc3: