Lineage for d6a8pc2 (6a8p C:146-463)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2497635Family d.3.1.4: Transglutaminase core [54044] (3 proteins)
  6. 2497641Protein Transglutaminase catalytic domain [54045] (4 species)
  7. 2497679Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [75333] (5 PDB entries)
    GDP-binding protein
  8. 3058120Domain d6a8pc2: 6a8p C:146-463 [358182]
    Other proteins in same PDB: d6a8pa1, d6a8pa3, d6a8pa4, d6a8pa5, d6a8pb1, d6a8pb3, d6a8pb4, d6a8pb5, d6a8pc1, d6a8pc3, d6a8pc4
    automated match to d3ly6a2
    complexed with gtp; mutant

Details for d6a8pc2

PDB Entry: 6a8p (more details), 2.54 Å

PDB Description: transglutaminase 2 mutant g224v in complex with gtp
PDB Compounds: (C:) Protein-glutamine gamma-glutamyltransferase 2

SCOPe Domain Sequences for d6a8pc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a8pc2 d.3.1.4 (C:146-463) Transglutaminase catalytic domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
davyldseeerqeyvltqqgfiyqgsakfiknipwnfgqfedgildiclilldvnpkflk
nagrdcsrrsspvyvgrvvsgmvncnddqgvllgrwdnnygdgvspmswigsvdilrrwk
nhgcqrvkygqcwvfaavactvlrclgiptrvvtnynsahdqnsnllieyfrnefgeiqg
dksemiwnfhcwveswmtrpdlqpgyegwqaldptpqeksegtyccgpvpvraikegdls
tkydapfvfaevnadvvdwiqqddgsvhksinrslivglkistksvgrderedithtyky
pegsseereaftranhln

SCOPe Domain Coordinates for d6a8pc2:

Click to download the PDB-style file with coordinates for d6a8pc2.
(The format of our PDB-style files is described here.)

Timeline for d6a8pc2:

  • d6a8pc2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-27