Lineage for d6a8pc1 (6a8p C:1-145)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361840Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2362437Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 2362438Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 2362476Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74844] (5 PDB entries)
    GDP-binding protein
  8. 3058119Domain d6a8pc1: 6a8p C:1-145 [358181]
    Other proteins in same PDB: d6a8pa2, d6a8pa3, d6a8pa4, d6a8pa5, d6a8pb2, d6a8pb3, d6a8pb4, d6a8pb5, d6a8pc2, d6a8pc3, d6a8pc4
    automated match to d3ly6a1
    complexed with gtp; mutant

Details for d6a8pc1

PDB Entry: 6a8p (more details), 2.54 Å

PDB Description: transglutaminase 2 mutant g224v in complex with gtp
PDB Compounds: (C:) Protein-glutamine gamma-glutamyltransferase 2

SCOPe Domain Sequences for d6a8pc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a8pc1 b.1.18.9 (C:1-145) Transglutaminase N-terminal domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
maeelvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfs
vvtgpapsqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsle
astgyqgssfvlghfillfnawcpa

SCOPe Domain Coordinates for d6a8pc1:

Click to download the PDB-style file with coordinates for d6a8pc1.
(The format of our PDB-style files is described here.)

Timeline for d6a8pc1:

  • d6a8pc1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-27