Lineage for d6mggb2 (6mgg B:240-387)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439017Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2439101Family c.23.4.0: automated matches [227303] (1 protein)
    not a true family
  6. 2439102Protein automated matches [227129] (4 species)
    not a true protein
  7. 3058008Species Francisella tularensis [TaxId:177416] [358070] (1 PDB entry)
  8. 3058105Domain d6mggb2: 6mgg B:240-387 [358167]
    Other proteins in same PDB: d6mgga1, d6mgga3, d6mggb1, d6mggc1, d6mggc3, d6mggd1
    automated match to d2nu8e1
    complexed with coa, edo, mg

Details for d6mggb2

PDB Entry: 6mgg (more details), 1.78 Å

PDB Description: succinyl-coa synthase from francisella tularensis, phosphorylated, in complex with coa
PDB Compounds: (B:) Succinate--CoA ligase [ADP-forming] subunit beta

SCOPe Domain Sequences for d6mggb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mggb2 c.23.4.0 (B:240-387) automated matches {Francisella tularensis [TaxId: 177416]}
nakelkasehelnyvalegnigcmvngaglamatmdiiqlyggkpanfldvgggatkerv
ieafklilddenvkailinifggivrcdmiaeaiieavkevnvtvpvvvrlegnnaekga
kiladsglklipadgladaadkvvkslg

SCOPe Domain Coordinates for d6mggb2:

Click to download the PDB-style file with coordinates for d6mggb2.
(The format of our PDB-style files is described here.)

Timeline for d6mggb2:

  • d6mggb2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-27