Lineage for d6g46c1 (6g46 C:7-120)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361566Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) (S)
  5. 2361585Family b.1.12.0: automated matches [227279] (1 protein)
    not a true family
  6. 2361586Protein automated matches [227090] (1 species)
    not a true protein
  7. 2361587Species French bean (Phaseolus vulgaris) [TaxId:3885] [226471] (7 PDB entries)
  8. 3058094Domain d6g46c1: 6g46 C:7-120 [358156]
    Other proteins in same PDB: d6g46a2, d6g46b2, d6g46c2, d6g46d2
    automated match to d1kbpa1
    complexed with edo, elh, fe, fuc, gol, ipa, na, nag, so4, zn

Details for d6g46c1

PDB Entry: 6g46 (more details), 2.4 Å

PDB Description: red kidney bean purple acid phosphatase in complex with 2-(naphthalen- 1-yl)thiazole-4-carboxylic acid
PDB Compounds: (C:) Fe(3+)-Zn(2+) purple acid phosphatase

SCOPe Domain Sequences for d6g46c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g46c1 b.1.12.0 (C:7-120) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

SCOPe Domain Coordinates for d6g46c1:

Click to download the PDB-style file with coordinates for d6g46c1.
(The format of our PDB-style files is described here.)

Timeline for d6g46c1:

  • d6g46c1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-27