SCOPe 2.07: Domain d5zx8a1: 5zx8 A:1-182

Lineage for d5zx8a1 (5zx8 A:1-182)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.0: automated matches [193325] (1 protein)
   not a true family

6. Protein automated matches [193326] (11 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [358143] (1 PDB entry)

8. Domain d5zx8a1: 5zx8 A:1-182 [358144]
   Other proteins in same PDB: d5zx8a2
   automated match to d5ivpb_
   complexed with flc, mpd

Details for d5zx8a1

PDB Entry: 5zx8, 1 Å

PDB Description: crystal structure of peptidyl-trna hydrolase from thermus thermophilus

PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d5zx8a1:

Sequence; same for both SEQRES and ATOM records:

>d5zx8a1 c.56.3.0 (A:1-182) automated matches {Thermus thermophilus [TaxId: 300852]}
mflvvgqgnpgeryartrhnlgfmvldrlglsfrprgealvaeaegglflkpltyynltg
ravaplarfykipperilvvhdemdlplgrirfkaggsaagnrgvlsieealgtrafhrl
rlgigkppdpsrgaeyvlspfreeelpvvervleaakeavwcwvreglppcagrfngldl
sl

Timeline for d5zx8a1:

• d5zx8a1 is new in SCOPe 2.07-stable
  
• d5zx8a1 appears in the current release, SCOPe 2.08