Lineage for d5zx8a1 (5zx8 A:1-182)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889282Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2889299Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2889300Protein automated matches [193326] (11 species)
    not a true protein
  7. 2889376Species Thermus thermophilus [TaxId:300852] [358143] (1 PDB entry)
  8. 2889377Domain d5zx8a1: 5zx8 A:1-182 [358144]
    Other proteins in same PDB: d5zx8a2
    automated match to d5ivpb_
    complexed with flc, mpd

Details for d5zx8a1

PDB Entry: 5zx8 (more details), 1 Å

PDB Description: crystal structure of peptidyl-trna hydrolase from thermus thermophilus
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d5zx8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zx8a1 c.56.3.0 (A:1-182) automated matches {Thermus thermophilus [TaxId: 300852]}
mflvvgqgnpgeryartrhnlgfmvldrlglsfrprgealvaeaegglflkpltyynltg
ravaplarfykipperilvvhdemdlplgrirfkaggsaagnrgvlsieealgtrafhrl
rlgigkppdpsrgaeyvlspfreeelpvvervleaakeavwcwvreglppcagrfngldl
sl

SCOPe Domain Coordinates for d5zx8a1:

Click to download the PDB-style file with coordinates for d5zx8a1.
(The format of our PDB-style files is described here.)

Timeline for d5zx8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zx8a2