Lineage for d6mfmb2 (6mfm B:137-304)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2540993Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2540994Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2541068Family d.139.1.0: automated matches [227182] (1 protein)
    not a true family
  6. 2541069Protein automated matches [226902] (11 species)
    not a true protein
  7. 2541070Species Acinetobacter baumannii [TaxId:470] [276304] (4 PDB entries)
  8. 3058075Domain d6mfmb2: 6mfm B:137-304 [358137]
    Other proteins in same PDB: d6mfma1, d6mfmb1
    automated match to d5cm7a2
    complexed with adp, mg, na, tpp

Details for d6mfmb2

PDB Entry: 6mfm (more details), 1.9 Å

PDB Description: structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with adenosine diphosphate (adp) and thiamine diphosphate (tpp), orthorhombic crystal form
PDB Compounds: (B:) Thiamine-monophosphate kinase

SCOPe Domain Sequences for d6mfmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mfmb2 d.139.1.0 (B:137-304) automated matches {Acinetobacter baumannii [TaxId: 470]}
tgkavlrsgakvgdyvcvsgqigdaayglqhlghslqqrldyptprcklgeelkglassm
idvsdglaqdlghilkaskvgarlileklpvdpvlqqieeqqrwqyalaggddyelcfti
tpqnyekllqkqldvkitmigqiveqtkltfehlgsdyplqihgyqhf

SCOPe Domain Coordinates for d6mfmb2:

Click to download the PDB-style file with coordinates for d6mfmb2.
(The format of our PDB-style files is described here.)

Timeline for d6mfmb2:

  • d6mfmb2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-27

View in 3D
Domains from same chain:
(mouse over for more information)
d6mfmb1