SCOPe 2.08: Domain d6mfmb2: 6mfm B:137-304

Lineage for d6mfmb2 (6mfm B:137-304)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.0: automated matches [227182] (1 protein)
   not a true family

6. Protein automated matches [226902] (12 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [276304] (4 PDB entries)

8. Domain d6mfmb2: 6mfm B:137-304 [358137]
   Other proteins in same PDB: d6mfma1, d6mfmb1
   automated match to d5cm7a2
   complexed with adp, mg, na, tpp

Details for d6mfmb2

PDB Entry: 6mfm, 1.9 Å

PDB Description: structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with adenosine diphosphate (adp) and thiamine diphosphate (tpp), orthorhombic crystal form

PDB Compounds: (B:) Thiamine-monophosphate kinase

SCOPe Domain Sequences for d6mfmb2:

Sequence; same for both SEQRES and ATOM records:

>d6mfmb2 d.139.1.0 (B:137-304) automated matches {Acinetobacter baumannii [TaxId: 470]}
tgkavlrsgakvgdyvcvsgqigdaayglqhlghslqqrldyptprcklgeelkglassm
idvsdglaqdlghilkaskvgarlileklpvdpvlqqieeqqrwqyalaggddyelcfti
tpqnyekllqkqldvkitmigqiveqtkltfehlgsdyplqihgyqhf

Timeline for d6mfmb2:

• d6mfmb2 first appeared in SCOPe 2.07