Lineage for d6mfmb1 (6mfm B:1-136)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525989Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 2526074Family d.79.4.0: automated matches [227181] (1 protein)
    not a true family
  6. 2526075Protein automated matches [226901] (9 species)
    not a true protein
  7. 2526076Species Acinetobacter baumannii [TaxId:470] [276302] (4 PDB entries)
  8. 3058074Domain d6mfmb1: 6mfm B:1-136 [358136]
    Other proteins in same PDB: d6mfma2, d6mfmb2
    automated match to d5cm7a1
    complexed with adp, mg, na, tpp

Details for d6mfmb1

PDB Entry: 6mfm (more details), 1.9 Å

PDB Description: structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with adenosine diphosphate (adp) and thiamine diphosphate (tpp), orthorhombic crystal form
PDB Compounds: (B:) Thiamine-monophosphate kinase

SCOPe Domain Sequences for d6mfmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mfmb1 d.79.4.0 (B:1-136) automated matches {Acinetobacter baumannii [TaxId: 470]}
maefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfpletsphai
gwksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgvaliggdtt
qgphltitvtamgwie

SCOPe Domain Coordinates for d6mfmb1:

Click to download the PDB-style file with coordinates for d6mfmb1.
(The format of our PDB-style files is described here.)

Timeline for d6mfmb1:

  • d6mfmb1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-27

View in 3D
Domains from same chain:
(mouse over for more information)
d6mfmb2