Lineage for d5zxbb_ (5zxb B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2542373Protein Activated CDC42 kinase 1, ACK1 [111200] (1 species)
    PTK group; Tck subfamily; non-membrane spanning protein tyrosine kinase
  7. 2542374Species Human (Homo sapiens) [TaxId:9606] [111201] (9 PDB entries)
    Uniprot Q07912 117-389
  8. 3058072Domain d5zxbb_: 5zxb B: [358134]
    automated match to d4ewha_
    complexed with 9ko

Details for d5zxbb_

PDB Entry: 5zxb (more details), 2.2 Å

PDB Description: crystal structure of ack1 with compound 10d
PDB Compounds: (B:) Activated CDC42 kinase 1

SCOPe Domain Sequences for d5zxbb_:

Sequence, based on SEQRES records: (download)

>d5zxbb_ d.144.1.7 (B:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]}
ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvlsqpeamddfir
evnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqv
aegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfaw
capeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedc
pqdiynvmvqcwahkpedrptfvalrdflleaq

Sequence, based on observed residues (ATOM records): (download)

>d5zxbb_ d.144.1.7 (B:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]}
ltcligekdlrlleklgdvvrrgewdapsgktvsvavkclqpeamddfirevnamhsldh
rnlirlygvvltppmkmvtelaplgslldrlrkhqghflgtlsryavqvaegmgyleskr
fihrdlaarnlllatrdlvkigdfpfawcapeslktrtfshasdtwmfgvtlwemftygq
epwiglngsqilhkidkegerlprpedcpqdiynvmvqcwahkpedrptfvalrdfllea
q

SCOPe Domain Coordinates for d5zxbb_:

Click to download the PDB-style file with coordinates for d5zxbb_.
(The format of our PDB-style files is described here.)

Timeline for d5zxbb_:

  • d5zxbb_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-27