SCOPe 2.08: Domain d6h8ra1: 6h8r A:282-562

Lineage for d6h8ra1 (6h8r A:282-562)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.0: automated matches [191381] (1 protein)
   not a true family

6. Protein automated matches [190475] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries)

8. Domain d6h8ra1: 6h8r A:282-562 [358118]
   Other proteins in same PDB: d6h8ra2
   automated match to d3o4ua_
   complexed with fwb, so4

Details for d6h8ra1

PDB Entry: 6h8r, 1.66 Å

PDB Description: crystal structure of the human protein tyrosine phosphatase ptpn5 (step) in complex with compound 2

PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 5

SCOPe Domain Sequences for d6h8ra1:

Sequence; same for both SEQRES and ATOM records:

>d6h8ra1 c.45.1.0 (A:282-562) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srvlqaeelhekaldpfllqaeffeipmnfvdpkeydipglvrknryktilpnphsrvcl
tspdpddplssyinanyirgyggeekvyiatqgpivstvadfwrmvwqehtpiivmitni
eemnekcteywpeeqvaydgveitvqkvihtedyrlrlislksgteerglkhywftswpd
qktpdrappllhlvreveeaaqqegphcapiivhcsagigrtgcfiatsiccqqlrqegv
vdilkttcqlrqdrggmiqtceqyqfvhhvmslyekqlshq

Timeline for d6h8ra1:

• d6h8ra1 first appeared in SCOPe 2.07