Lineage for d5nhnb1 (5nhn B:3-231)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2508387Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2508388Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2508389Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2508715Protein automated matches [190406] (18 species)
    not a true protein
  7. 2508906Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (39 PDB entries)
  8. 3058048Domain d5nhnb1: 5nhn B:3-231 [358110]
    Other proteins in same PDB: d5nhna2, d5nhnb2
    automated match to d2b3pa_
    complexed with db5, edo, gol

Details for d5nhnb1

PDB Entry: 5nhn (more details), 1.96 Å

PDB Description: super-folder green fluorescent protein artificiall dimer linked via 148 position
PDB Compounds: (B:) Green fluorescent protein

SCOPe Domain Sequences for d5nhnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nhnb1 d.22.1.1 (B:3-231) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvt
tlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnr
ielkgidfkedgnilghkleynfnsknvyitadkqkngikanfkirhnvedgsvqladhy
qqntpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagith

SCOPe Domain Coordinates for d5nhnb1:

Click to download the PDB-style file with coordinates for d5nhnb1.
(The format of our PDB-style files is described here.)

Timeline for d5nhnb1:

  • d5nhnb1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5nhnb2