SCOPe 2.08: Domain d1poy3_: 1poy 3:

Lineage for d1poy3_ (1poy 3:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Spermidine/putrescine-binding protein PotD [53875] (1 species)

7. Species Escherichia coli [TaxId:562] [53876] (2 PDB entries)

8. Domain d1poy3_: 1poy 3: [35810]
   complexed with spd
   has additional insertions and/or extensions that are not grouped together

Details for d1poy3_

PDB Entry: 1poy, 2.5 Å

PDB Description: spermidine/putrescine-binding protein complexed with spermidine (dimer form)

PDB Compounds: (3:) spermidine/putrescine-binding protein

SCOPe Domain Sequences for d1poy3_:

Sequence; same for both SEQRES and ATOM records:

>d1poy3_ c.94.1.1 (3:) Spermidine/putrescine-binding protein PotD {Escherichia coli [TaxId: 562]}
nntlyfynwteyvppglleqftketgikviystyesnetmyaklktykdgaydlvvpsty
yvdkmrkegmiqkidkskltnfsnldpdmlnkpfdpnndysipyiwgataigvngdavdp
ksvtswadlwkpeykgsllltddarevfqmalrklgysgnttdpkeieaaynelkklmpn
vaafnsdnpanpymegevnlgmiwngsafvarqagtpidvvwpkeggifwmdslaipana
knkegalklinfllrpdvakqvaetigyptpnlaarkllspevandktlypdaetiknge
wqndvgaassiyeeyyqklkagr

Timeline for d1poy3_:

• d1poy3_ first appeared (with stable ids) in SCOP 1.55
  
• d1poy3_ appears in SCOPe 2.07