Lineage for d6mg6b1 (6mg6 B:1-292)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556576Fold d.160: Carbon-nitrogen hydrolase [56316] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2556577Superfamily d.160.1: Carbon-nitrogen hydrolase [56317] (3 families) (S)
    Pfam PF00795; some topological similarities to the metallo-dependent phosphatases and DNase I-like nucleases
  5. 2556644Family d.160.1.0: automated matches [191429] (1 protein)
    not a true family
  6. 2556645Protein automated matches [190617] (5 species)
    not a true protein
  7. 3058036Species Helicobacter pylori [TaxId:563041] [358098] (1 PDB entry)
  8. 3058037Domain d6mg6b1: 6mg6 B:1-292 [358099]
    Other proteins in same PDB: d6mg6a2, d6mg6b2, d6mg6c2, d6mg6d2
    automated match to d5h8ic_
    complexed with so4

Details for d6mg6b1

PDB Entry: 6mg6 (more details), 2.1 Å

PDB Description: crystal structure of carbon-nitrogen hydrolase from helicobacter pylori g27
PDB Compounds: (B:) Carbon-nitrogen hydrolase

SCOPe Domain Sequences for d6mg6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mg6b1 d.160.1.0 (B:1-292) automated matches {Helicobacter pylori [TaxId: 563041]}
miyagvlqhaycgsrkktiehtanlleqalkkhpktnlvvlqelnpysyfcqsenpkffd
lgeyfeedkaffsalaqkfqvvliaslfekrakglyhnsavvfekdgsiagvyrkmhipd
dpgfyekfyftpgdlgfepiitsvgklglmvcwdqwypeaarimalkgaeiliypsaigf
leedsneekkrqqnawetiqrghaianglpliatnrvgveldpsgaikggitffgssfvv
galgeflakasdkeeilyaeidlerteevrrmwpflrdrridfyndllkryi

SCOPe Domain Coordinates for d6mg6b1:

Click to download the PDB-style file with coordinates for d6mg6b1.
(The format of our PDB-style files is described here.)

Timeline for d6mg6b1:

  • d6mg6b1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-27