Lineage for d6cfnd_ (6cfn D:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586757Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2586758Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2586782Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. 2586864Protein automated matches [190314] (3 species)
    not a true protein
  7. 2586868Species Human (Homo sapiens) [TaxId:9606] [188623] (4 PDB entries)
  8. 3058030Domain d6cfnd_: 6cfn D: [358092]
    automated match to d1kb2b_
    complexed with zn

Details for d6cfnd_

PDB Entry: 6cfn (more details), 2.5 Å

PDB Description: crystal structure of the dna-free glucocorticoid receptor dna binding domain
PDB Compounds: (D:) Glucocorticoid receptor

SCOPe Domain Sequences for d6cfnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cfnd_ g.39.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacryr
kclqagmn

SCOPe Domain Coordinates for d6cfnd_:

Click to download the PDB-style file with coordinates for d6cfnd_.
(The format of our PDB-style files is described here.)

Timeline for d6cfnd_:

  • d6cfnd_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-27