Lineage for d6ciub_ (6ciu B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2508387Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2508388Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2509060Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2509061Protein automated matches [190526] (23 species)
    not a true protein
  7. 3057935Species Galaxea fascicularis [TaxId:46745] [357997] (1 PDB entry)
  8. 3058014Domain d6ciub_: 6ciu B: [358076]
    automated match to d1xssb_

Details for d6ciub_

PDB Entry: 6ciu (more details), 1.7 Å

PDB Description: structure of a thr-rich interface in an azami green tetramer
PDB Compounds: (B:) Azami-Green

SCOPe Domain Sequences for d6ciub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ciub_ d.22.1.0 (B:) automated matches {Galaxea fascicularis [TaxId: 46745]}
svikpemkiklcmrgtvnghnfviegegkgnpyegtqildlnvtegaplpfaydilttvf
qygnraftkypadiqdyfkqtfpegyhwersmtyedqgictatsnismrgdcffyditft
gtnfppngpvmqkktlkwepstekmyvrdgvlkgdvnmallleggghyrcdfkttykakk
dvrlpdyhfvdhrieilkhdkdynkvklyenavarysmlpsq

SCOPe Domain Coordinates for d6ciub_:

Click to download the PDB-style file with coordinates for d6ciub_.
(The format of our PDB-style files is described here.)

Timeline for d6ciub_:

  • d6ciub_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-27