Lineage for d6mgga1 (6mgg A:2-122)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (249 species)
    not a true protein
  7. 2431199Species Francisella tularensis [TaxId:177416] [195722] (3 PDB entries)
  8. 3058010Domain d6mgga1: 6mgg A:2-122 [358072]
    Other proteins in same PDB: d6mgga2, d6mgga3, d6mggb1, d6mggb2, d6mggc2, d6mggc3, d6mggd1, d6mggd2
    automated match to d2yv1a1
    complexed with coa, edo, mg

Details for d6mgga1

PDB Entry: 6mgg (more details), 1.78 Å

PDB Description: succinyl-coa synthase from francisella tularensis, phosphorylated, in complex with coa
PDB Compounds: (A:) Succinate--CoA ligase [ADP-forming] subunit alpha

SCOPe Domain Sequences for d6mgga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mgga1 c.2.1.0 (A:2-122) automated matches {Francisella tularensis [TaxId: 177416]}
svlvdkntkvlvqgftgkngtfhseqaiaygtnivggvtpgkggtthldrpvfntmaeav
aatgadasviyvpapfvkdsaievidsgvklvviitegvptldmlvvkeylkdkdvrvig
p

SCOPe Domain Coordinates for d6mgga1:

Click to download the PDB-style file with coordinates for d6mgga1.
(The format of our PDB-style files is described here.)

Timeline for d6mgga1:

  • d6mgga1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-27