Lineage for d6mggd1 (6mgg D:1-239)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541793Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2541794Protein automated matches [226904] (37 species)
    not a true protein
  7. 3058006Species Francisella tularensis [TaxId:177416] [358068] (1 PDB entry)
  8. 3058007Domain d6mggd1: 6mgg D:1-239 [358069]
    Other proteins in same PDB: d6mgga1, d6mgga2, d6mgga3, d6mggb2, d6mggc1, d6mggc2, d6mggc3, d6mggd2
    automated match to d2nu8b2
    complexed with coa, edo, mg

Details for d6mggd1

PDB Entry: 6mgg (more details), 1.78 Å

PDB Description: succinyl-coa synthase from francisella tularensis, phosphorylated, in complex with coa
PDB Compounds: (D:) Succinate--CoA ligase [ADP-forming] subunit beta

SCOPe Domain Sequences for d6mggd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mggd1 d.142.1.0 (D:1-239) automated matches {Francisella tularensis [TaxId: 177416]}
mnlheyqakdllesyglkvqkgivahnpneaaqafdqlggkfavvkaqvhaggrgkaggv
kvvkssqetrevaesligknlvtfqtdaegqpvnsvgvfedvypvtrelylgavvdrssr
kvtfmasteggvdieevahnspekilkvevdplvglqpfqarevafklglegkqindfvk
tmlgaykafiecdfalfeinplavrengeivcvdgkinldsnalyrhpkllalrdksqe

SCOPe Domain Coordinates for d6mggd1:

Click to download the PDB-style file with coordinates for d6mggd1.
(The format of our PDB-style files is described here.)

Timeline for d6mggd1:

  • d6mggd1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-27