Lineage for d6mdqa1 (6mdq A:4-195)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2336647Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2336648Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2337021Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2337022Protein automated matches [254493] (6 species)
    not a true protein
  7. 2337067Species Horse (Equus caballus) [TaxId:9796] [256129] (19 PDB entries)
  8. 3058003Domain d6mdqa1: 6mdq A:4-195 [358065]
    automated match to d1hk5a2
    complexed with flc, tes

Details for d6mdqa1

PDB Entry: 6mdq (more details), 2.15 Å

PDB Description: crystal structure of equine serum albumin in complex with testosterone
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d6mdqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mdqa1 a.126.1.0 (A:4-195) automated matches {Horse (Equus caballus) [TaxId: 9796]}
kseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesaencd
kslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepdaqc
aafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipklda
lkerillssake

SCOPe Domain Coordinates for d6mdqa1:

Click to download the PDB-style file with coordinates for d6mdqa1.
(The format of our PDB-style files is described here.)

Timeline for d6mdqa1:

  • d6mdqa1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-27