Lineage for d6erdb1 (6erd B:44-211)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533769Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2533770Protein automated matches [190038] (46 species)
    not a true protein
  7. 3057940Species Bacillus cereus [TaxId:226900] [358002] (1 PDB entry)
  8. 3057991Domain d6erdb1: 6erd B:44-211 [358053]
    Other proteins in same PDB: d6erda2, d6erdb2, d6erdc2, d6erdd2
    automated match to d5cnpb_
    complexed with cl, gol

Details for d6erdb1

PDB Entry: 6erd (more details), 2 Å

PDB Description: crystal structure of a putative acetyltransferase from bacillus cereus species.
PDB Compounds: (B:) Aminoglycoside N6'-acetyltransferase

SCOPe Domain Sequences for d6erdb1:

Sequence, based on SEQRES records: (download)

>d6erdb1 d.108.1.0 (B:44-211) automated matches {Bacillus cereus [TaxId: 226900]}
iklesfkksdfkqlinwinseefliqwsgnaftfpldeqqlekyiesantlafkvvdeet
sdvighislgqidninksarigkvlvgntkmrgrsigkhmmkavlhiafdelklhrvtlg
vydfntsaiscyekigfvkegllreskrvgetywnlwemsmleyewkk

Sequence, based on observed residues (ATOM records): (download)

>d6erdb1 d.108.1.0 (B:44-211) automated matches {Bacillus cereus [TaxId: 226900]}
iklesfkksdfkqlinwinseefliqwsgnaftfpldeqqlekyiesantlafkvvdeet
sdvighislgqidninksarigkvlvsigkhmmkavlhiafdelklhrvtlgvydfntsa
iscyekigfvkegllreskrvgetywnlwemsmleyewkk

SCOPe Domain Coordinates for d6erdb1:

Click to download the PDB-style file with coordinates for d6erdb1.
(The format of our PDB-style files is described here.)

Timeline for d6erdb1:

  • d6erdb1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-27