SCOPe 2.08: Domain d1hslb_: 1hsl B:

Lineage for d1hslb_ (1hsl B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Histidine-binding protein [53872] (2 species)

7. Species Escherichia coli [TaxId:562] [53873] (1 PDB entry)

8. Domain d1hslb_: 1hsl B: [35805]
   complexed with cd, his

Details for d1hslb_

PDB Entry: 1hsl, 1.89 Å

PDB Description: refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors

PDB Compounds: (B:) histidine-binding protein

SCOPe Domain Sequences for d1hslb_:

Sequence; same for both SEQRES and ATOM records:

>d1hslb_ c.94.1.1 (B:) Histidine-binding protein {Escherichia coli [TaxId: 562]}
aipqkirigtdptyapfesknaqgelvgfdidlakelckrintqctfvenpldalipslk
akkidaimsslsitekrqqeiaftdklyaadsrlvvaknsdiqptvaslkgkrvgvlqgt
tqetfgnehwapkgieivsyqgqdniysdltagridaafqdevaasegflkqpvgkdykf
ggpavkdeklfgvgtgmglrkednelrealnkafaemradgtyeklakkyfdfdvygg

Timeline for d1hslb_:

• d1hslb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hslb_ appears in SCOPe 2.07