Lineage for d6f04a1 (6f04 A:3-391)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330024Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2330025Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2330252Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2330253Protein automated matches [190108] (19 species)
    not a true protein
  7. 3057978Species Nostoc sp. [TaxId:457941] [358040] (1 PDB entry)
  8. 3057979Domain d6f04a1: 6f04 A:3-391 [358041]
    Other proteins in same PDB: d6f04a2
    automated match to d3wkfa_
    complexed with cl, edo

Details for d6f04a1

PDB Entry: 6f04 (more details), 1.7 Å

PDB Description: n-acetylglucosamine-2-epimerase
PDB Compounds: (A:) N-acetylglucosamine-2-epimerase

SCOPe Domain Sequences for d6f04a1:

Sequence, based on SEQRES records: (download)

>d6f04a1 a.102.1.0 (A:3-391) automated matches {Nostoc sp. [TaxId: 457941]}
ynfqalaelyknallndvlsfwekysldwqqggyftcldregkiydtdkfiwlqnrqvwt
fsmlynqlekrenwlkiasnganflaqhgrdsdgnwyfaltregkplvhpynifsdcfaa
mafskyalaggeewakdvamqaynnvlrrkdnpkgkynktypgtrpmkslavpmilanlt
lemewllpketlenvlaetvrevmtdfldqerglmyenvapdgshidcfegrlinpghgi
eamwfimdiarrqndtktinqavdvvlnilnfawdseygglyyfmdadghppqqlewdqk
lwwvhleslvalamgyrltgreacwewyqkmhdyawshfadseygewfgylnrrgevlln
lkggkwkgcfhvpralylcwqqfeaiatp

Sequence, based on observed residues (ATOM records): (download)

>d6f04a1 a.102.1.0 (A:3-391) automated matches {Nostoc sp. [TaxId: 457941]}
ynfqalaelyknallndvlsfwekysldwqqggyftcldregkiydtdkfiwlqnrqvwt
fsmlynqlekrenwlkiasnganflaqhgrdsdgnwyfaltregkplvhpynifsdcfaa
mafskyalaggeewakdvamqaynnvlrrkdnpkgtrpmkslavpmilanltlemewllp
ketlenvlaetvrevmtdfldqerglmyenvapdgshidcfegrlinpghgieamwfimd
iarrqndtktinqavdvvlnilnfawdseygglyyfmdadghppqqlewdqklwwvhles
lvalamgyrltgreacwewyqkmhdyawshfadseygewfgylnrrgevllnlkggkwkg
cfhvpralylcwqqfeaiatp

SCOPe Domain Coordinates for d6f04a1:

Click to download the PDB-style file with coordinates for d6f04a1.
(The format of our PDB-style files is described here.)

Timeline for d6f04a1:

  • d6f04a1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-27

View in 3D
Domains from same chain:
(mouse over for more information)
d6f04a2